PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.9C0A1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 225aa    MW: 24772.3 Da    PI: 7.152
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.9C0A1genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.41e-42551541100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la+++
  Araip.9C0A1  55 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAQLAKAQ 152
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Araip.9C0A1 153 AE 154
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.18154155IPR004883Lateral organ boundaries, LOB
PfamPF031959.1E-4355152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEYKLNSSPS IPIIHVPTKI SNSPPPPSSS PPNSQSQSPT SCAPPSPPPP VVVSPCAACK  60
ILRRRCVEKC VLAPYFPPTD PLKFTIAHRV FGASNIIKFL QELPESQRAD AVSSMVYEAN  120
ARIRDPVYGC AGAICQLQKQ VSELQAQLAK AQAELVNMHC QQTNLVALIC MEMSTSNTHQ  180
SSSHQEQHHM MMIQPQNNNN NNNHVDMSCF IDDNNLASAW EPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016174204.11e-165PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR05e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLI3T4515e-98I3T451_LOTJA; Uncharacterized protein
STRINGGLYMA10G35760.19e-95(Glycine max)
STRINGGLYMA20G31780.11e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-55LOB domain-containing protein 1